Skin
GHK-Cu vs LL-37: A Canadian Skin & Wound-Healing Research Comparison
Table of contents
Table of contents
- Why this comparison belongs in the skin archive
- The short answer: same tissue, different research questions
- Live Canadian sourcing answer: which product page should a researcher inspect first?
- Molecular identity: size, sequence, and charge
- GHK-Cu: the copper-binding tripeptide
- LL-37: the human cathelicidin
- Mechanistic divergence: remodelling versus defence
- GHK-Cu and the tissue-remodelling programme
- LL-37 and the innate-immunity programme
- Wound-healing models: where the comparison matters
- The inflammatory phase
- The proliferative phase
- The remodelling phase
- Infected versus sterile wounds
- Skin-specific endpoints: collagen, barrier, pigmentation, and infection
- Collagen and photoaging
- Barrier function
- Pigmentation
- Infection and biofilm control
- Cytotoxicity and formulation constraints
- LL-37 concentration dependence
- GHK-Cu safety margin
- Topical formulation differences
- Sourcing and analytical standards
- GHK-Cu documentation
- LL-37 documentation
- Study-design checklist for GHK-Cu versus LL-37
- Frequently asked questions
- Bottom line for Canadian researchers
Why this comparison belongs in the skin archive
GHK-Cu vs LL-37 is a comparison that Canadian skin researchers should be able to find in the archive, even though the two peptides are rarely discussed side by side in the marketing literature. Supplier pages usually group them under a generic "skin peptides" or "recovery peptides" umbrella, which flattens two radically different molecules into the same product category. That flattening is misleading for research design.
Northern Compound already maintains dedicated guides to GHK-Cu and LL-37, a topical peptides methodology guide, and a best skin peptides buyer guide. Those articles explain each compound in isolation. The gap is the decision layer: when a Canadian researcher sees both peptides on a supplier menu and wants to know which one matches their experimental question, what should they compare first?
The responsible answer starts with size and charge. GHK-Cu is a tripeptide of roughly 340 daltons, small enough to be an exception to the usual transdermal penetration rules. LL-37 is a 37-amino-acid peptide of roughly 4,493 daltons, far above conventional transdermal cutoffs and heavily cationic. GHK-Cu binds copper and modulates gene expression related to tissue remodelling. LL-37 disrupts microbial membranes and modulates immune cell recruitment. These are not variations on the same theme. They are different research tools for different hypotheses.
This comparison does not tell readers which compound to use. It does not provide dose conversions, formulation recipes, or personal-use recommendations. It asks a narrower editorial question: what does the literature support for each molecule, where do marketing claims overreach, and what must a Canadian lab verify before relying on a vial label?
The short answer: same tissue, different research questions
If the research question is extracellular matrix remodelling, collagen synthesis, angiogenesis, or copper-dependent signalling in dermal fibroblasts, GHK-Cu is the directly aligned molecule. If the research question is antimicrobial defence, biofilm disruption, immune cell chemotaxis, or barrier dysfunction in the context of infection or inflammation, LL-37 is the more appropriate tool.
That table is deliberately practical. The usual internet comparison asks which peptide is better for skin or wound healing. Northern Compound does not answer that question because it implies a universal personal-use protocol. The better research comparison asks which molecule matches the mechanism and endpoint under study.
Live Canadian sourcing answer: which product page should a researcher inspect first?
For high-intent searches like "where to buy GHK-Cu in Canada," "where to buy LL-37 in Canada," or "GHK-Cu versus LL-37 which to buy," the useful answer is not a shopping ranking. It is a routing decision. The compound page a researcher opens first should match the biological question, then the batch documentation should decide whether the material is acceptable for the protocol.
| Buyer-intent query | First live ProductLink to inspect | Why that route fits | Internal due-diligence context |
|---|---|---|---|
| "Where to buy GHK-Cu Canada research" | GHK-Cu | Best aligned with copper-peptide identity, dermal matrix remodelling, fibroblast behaviour, collagen, elastin, angiogenesis, and oxidative-stress endpoints | GHK-Cu Canada guide, dermal collagen peptides, best skin peptides Canada |
| "Where to buy LL-37 Canada research" | LL-37 | Best aligned with cathelicidin biology, antimicrobial defence, biofilm models, barrier immunity, chemotaxis, and innate immune signalling | LL-37 Canada guide, skin barrier peptides, wound-healing peptides |
| "GHK-Cu or LL-37 for wound research" | Open both only if the study separates remodelling from defence | A clean comparison needs independent endpoints. GHK-Cu should not be treated as an antimicrobial substitute, and LL-37 should not be treated as a collagen peptide | research peptide buying guide, topical peptides guide |
This is also where unavailable-product discipline matters. Cosmetic-grade GHK-Cu can be an important editorial topic for formulation research, but a dead or uncertain product slug should not be routed through a live ProductLink. If the task is topical-formulation methodology, use the topical peptides guide and the best skin peptides guide for context. If the task is purchasing research material through a live catalogue path, keep the attributed ProductLinks on GHK-Cu and LL-37.
Before comparing price or vial size, inspect the current lot documentation. A useful Canadian supplier page should show a current COA, not a generic historical sample. For GHK-Cu, the page should clarify whether the material is the copper complex, free GHK, or another copper-peptide format. For LL-37, it should clarify sequence identity, purity, endotoxin expectations, storage, and RUO claim boundaries. If those details are missing, the better move is to keep researching rather than force a purchase decision from weak documentation.
Molecular identity: size, sequence, and charge
Understanding the structural differences between GHK-Cu and LL-37 is foundational to understanding everything that follows. They are not variations on the same molecule. They differ by more than an order of magnitude in molecular weight, by opposite charge profiles at physiological pH, and by completely different biological origins.
GHK-Cu: the copper-binding tripeptide
GHK is the tripeptide glycyl-L-histidyl-L-lysine. In its research-relevant form it is usually discussed as the copper(II) complex GHK-Cu, where copper is coordinated through the histidine nitrogen and lysine side chain. The free peptide has a molecular weight of approximately 340 daltons. The copper complex is slightly heavier depending on the oxidation state and counter-ions.
The peptide was originally isolated from human plasma by Loren Pickart in the 1970s, who observed that liver extracts from young animals contained a fraction that could stimulate older liver tissue. The active fraction was identified as GHK, and subsequent work established that copper binding was essential for many of its biological activities (Pickart et al., 2015).
GHK-Cu is unusual among bioactive peptides because it is small enough to penetrate the stratum corneum under certain formulation conditions. The 500-dalton rule for transdermal penetration is not an absolute cutoff, but it is a useful heuristic. GHK-Cu sits well below it. Its moderate lipophilicity when copper-bound, combined with its small size, has made it a focus of cosmetic formulation research as well as basic wound-healing science.
At the bench level, synthesis quality is generally high because a three-amino-acid sequence is trivial to manufacture by solid-phase peptide synthesis. The main analytical concerns are copper content (the peptide should not be supplied as the apo-peptide if the research question concerns copper-dependent signalling), salt form, and purity. A credible COA for GHK-Cu should confirm peptide identity, copper content, and absence of heavy-metal contaminants.
LL-37: the human cathelicidin
LL-37 is the sole cathelicidin antimicrobial peptide in humans. It is released by proteolytic cleavage from the C-terminus of the hCAP-18 precursor protein. The mature peptide is 37 amino acids long, with a molecular weight of approximately 4,493 daltons. Its sequence is [LL-37, 37 aa], beginning with two leucine residues that give the peptide its common name.
At physiological pH, LL-37 carries a strong net positive charge due to its high content of lysine and arginine residues. That cationic character is central to its antimicrobial mechanism: it interacts electrostatically with the negatively charged phosphate headgroups of bacterial membranes, disrupts membrane integrity, and kills the target microbe. The same property, however, means that LL-37 can also interact with mammalian cell membranes at sufficiently high concentrations, producing cytotoxicity that is not a manufacturing defect but a mechanistic feature of the molecule.
LL-37 adopts an alpha-helical structure in membrane-mimetic environments. That helical conformation is important for both antimicrobial activity and immune-modulatory signalling. The peptide binds to formyl peptide receptor-like 1 (FPRL1) on neutrophils, monocytes, and other immune cells, triggering chemotaxis and cytokine release. It also interacts with Toll-like receptors and P2X7 purinergic receptors, giving it a broad signalling profile that extends well beyond simple membrane disruption.
For Canadian researchers, the size and charge of LL-37 create practical constraints. It is not a topical peptide in the same sense as GHK-Cu. Passive penetration through intact stratum corneum is implausible. Any research protocol that uses LL-37 for skin or wound models must account for delivery method, concentration, and the risk of cytotoxicity to host cells.
At a glance
~340 Da
GHK-Cu molecular weight
At a glance
~4,493 Da
LL-37 molecular weight
Mechanistic divergence: remodelling versus defence
The central distinction between GHK-Cu and LL-37 is not which tissue they affect, but which biological process they primarily modulate. GHK-Cu is a remodelling signal. LL-37 is a defence signal. Both can influence wound healing, but they do so from opposite directions.
GHK-Cu and the tissue-remodelling programme
GHK-Cu does not act through a single classical receptor. Instead, it functions as a gene-expression modulator that upregulates and downregulates a large set of genes involved in tissue repair, remodelling, and antioxidant defence. Pickart and colleagues have described GHK-Cu as affecting approximately 4,000 human genes, resetting their expression to a more youthful pattern in cell-culture models (Pickart et al., 2015).
The most relevant pathways for skin research include:
- Collagen and elastin synthesis. GHK-Cu increases collagen types I, II, and III in fibroblast cultures, and increases decorin and elastin expression. It also suppresses the expression of matrix metalloproteinases (MMP-1 and MMP-2) that degrade collagen in aged or photodamaged skin.
- Angiogenesis. GHK-Cu stimulates vascular endothelial growth factor (VEGF) expression and promotes endothelial cell migration and tubule formation. This vascular support is relevant to wound healing because new vessel ingrowth is often the rate-limiting step in tissue repair.
- Copper-dependent antioxidant activity. The copper complex possesses superoxide dismutase-like activity, scavenging free radicals and reducing oxidative stress in wounded tissue. This antioxidant dimension distinguishes GHK-Cu from growth-factor-only approaches.
- Wound contraction and re-epithelialisation. In animal models, GHK-Cu accelerates wound closure, increases granulation tissue formation, and improves the tensile strength of healed wounds (PMC6073405).
The common thread is constructive remodelling. GHK-Cu appears to signal fibroblasts and endothelial cells to rebuild the extracellular matrix, replace damaged collagen, and support new vasculature. It does not kill microbes. It does not recruit neutrophils. Its role is architectural.
LL-37 and the innate-immunity programme
LL-37's primary role is host defence. It kills bacteria, fungi, and enveloped viruses by disrupting their membranes. In skin and wound contexts, that antimicrobial activity is valuable because infected wounds heal more slowly and more poorly than clean wounds. But LL-37 is not merely an antimicrobial drug. It is also a signalling molecule that coordinates the immune response.
The most relevant pathways for skin research include:
- Direct antimicrobial activity. LL-37 is active against Gram-positive and Gram-negative bacteria, including Staphylococcus aureus and Pseudomonas aeruginosa, two of the most common pathogens in chronic wounds. It also shows activity against biofilms, which are a major barrier to wound healing in clinical practice (PMC3699762).
- Immune cell chemotaxis. LL-37 attracts neutrophils, monocytes, and T-cells through FPRL1 signalling. This chemotactic activity can be beneficial in the early inflammatory phase of wound healing, where immune cell recruitment is necessary for debris clearance and pathogen control. It can also be detrimental if inflammation persists and becomes chronic.
- Re-epithelialisation signalling. LL-37 has been reported to promote keratinocyte migration and proliferation in wound-edge models. This effect is distinct from its antimicrobial activity and appears to involve growth-factor-like signalling rather than membrane disruption.
- Cytokine modulation. LL-37 can induce or suppress cytokine release depending on context, concentration, and cell type. In some models it reduces excessive inflammation; in others it amplifies inflammatory signalling. That context dependence is important for research design.
The common thread is defensive coordination. LL-37 controls microbial burden, recruits immune cells, and modulates inflammation. It does not directly stimulate collagen synthesis. It does not remodel the extracellular matrix. Its role is protective and immunomodulatory.
Wound-healing models: where the comparison matters
Wound healing is not a single process. It involves haemostasis, inflammation, proliferation, and remodelling. Different peptides dominate at different stages, and a researcher who assumes that GHK-Cu and LL-37 are interchangeable wound-healing agents may design a protocol that tests the wrong mechanism.
The inflammatory phase
In the first days after injury, the wound is colonised by microbes, infiltrated by neutrophils and macrophages, and flooded with inflammatory cytokines. LL-37 is highly relevant here. It is released by neutrophils, keratinocytes, and mast cells at the wound edge, where it kills bacteria and attracts additional immune cells. Research protocols that study early wound infection, biofilm formation, or immune cell recruitment should consider LL-37 as a relevant variable.
GHK-Cu is less central to the inflammatory phase. It does not kill microbes and does not recruit neutrophils. Its primary effects occur later, during the proliferative and remodelling phases. A protocol that measures only early inflammation and uses GHK-Cu as the independent variable may produce null results not because GHK-Cu is inactive, but because the endpoint is temporally mismatched.
The proliferative phase
During proliferation, fibroblasts deposit collagen, endothelial cells form new vessels, and keratinocytes migrate across the wound bed to re-establish epithelial coverage. Both GHK-Cu and LL-37 have been reported to influence this phase, but through different mechanisms.
GHK-Cu promotes fibroblast collagen synthesis, endothelial cell migration, and VEGF-driven angiogenesis. These are direct remodelling effects. A researcher studying granulation tissue quality, vascular density, or collagen fibre organisation might select GHK-Cu as the independent variable.
LL-37 promotes keratinocyte migration and proliferation, which supports re-epithelialisation. It also maintains a controlled microbial environment that allows proliferation to proceed without infection-related setbacks. A researcher studying epithelial closure speed in a contaminated wound model might select LL-37 as the independent variable.
The remodelling phase
Remodelling begins weeks after injury and can continue for months. Collagen is reorganised from type III to type I, cross-linking increases, and excess vasculature regresses. GHK-Cu is relevant here because it modulates MMP expression and supports collagen quality. LL-37 is less relevant because the inflammatory and antimicrobial pressures that define its role have typically diminished by this stage.
Infected versus sterile wounds
The most important practical distinction is whether the wound model includes microbial challenge. In a sterile incision model, LL-37 has no microbial targets and its primary rationale is weakened. GHK-Cu remains relevant because remodelling occurs regardless of infection status. In a contaminated or biofilm-infected wound model, LL-37 gains relevance because microbial control becomes a rate-limiting variable, while GHK-Cu alone may be insufficient if the bacterial burden is high.
A sophisticated research design might ask whether combining remodelling and defence signals produces better outcomes than either alone. That question is legitimate, but it requires a factorial design with appropriate controls: vehicle, GHK-Cu alone, LL-37 alone, and the combination. The analytical burden is higher because both peptides require independent identity confirmation and because LL-37's cytotoxicity must be controlled across the concentration range.
Skin-specific endpoints: collagen, barrier, pigmentation, and infection
Beyond wound healing, the skin archive includes research on photoaging, barrier function, pigmentation, and cosmetic formulation. GHK-Cu and LL-37 map onto these endpoints very differently.
Collagen and photoaging
GHK-Cu has a well-documented literature on collagen synthesis in fibroblast cultures, dermal explants, and human skin biopsy models. It is one of the few peptides with published human data in the cosmetic domain, including studies on wrinkle depth, skin laxity, and dermal thickness. That literature should not be translated into therapeutic claims, but it does provide a stronger evidentiary foundation for collagen-related research questions than most other peptides in the catalogue.
LL-37 has no comparable collagen literature. It does not stimulate fibroblast collagen production directly. Any effect on dermal remodelling would be indirect, mediated through inflammation resolution or microbial control.
Barrier function
The skin barrier is maintained by the stratum corneum, tight junctions in the granular layer, and the lipid matrix between corneocytes. LL-37 is expressed in the epidermis and contributes to barrier immunity. It kills microbes that attempt to colonise the skin surface and signals keratinocytes to maintain defensive readiness. Research protocols that study barrier dysfunction in atopic dermatitis, psoriasis, or wound models may find LL-37 relevant.
GHK-Cu does not directly influence barrier lipids or tight junctions. Its barrier relevance is limited to wound-edge remodelling, where re-epithelialisation restores barrier integrity indirectly.
Pigmentation
Neither GHK-Cu nor LL-37 is a pigmentation peptide in the sense that melanocortin analogues such as Melanotan-1 or Melanotan-2 are. GHK-Cu has been reported to influence melanocyte gene expression in some culture models, but this is not its primary research identity. LL-37 has no significant pigmentation literature.
Infection and biofilm control
This is LL-37's domain. Chronic wounds, diabetic ulcers, and burn wounds are frequently complicated by biofilm-forming bacteria that resist conventional antibiotics. LL-37 has demonstrated antibiofilm activity in vitro against multiple wound pathogens. A research protocol that studies biofilm disruption in a wound model would select LL-37, not GHK-Cu.
GHK-Cu does have some antimicrobial activity in copper-dependent contexts, but it is not a primary antimicrobial agent. Its MIC values against common skin pathogens are far higher than LL-37's, and it does not disrupt biofilms effectively.
Cytotoxicity and formulation constraints
One of the most important practical differences between these peptides is that LL-37 can kill the cells the researcher is trying to study, while GHK-Cu generally cannot.
LL-37 concentration dependence
LL-37's antimicrobial mechanism is membrane disruption. At low concentrations, it selectively disrupts microbial membranes due to their higher negative charge density. At high concentrations, the selectivity window narrows and mammalian cells become vulnerable. The cytotoxic threshold varies with cell type, membrane composition, salt concentration, pH, and the presence of serum proteins that can bind and neutralise the peptide.
In cell-culture research, this means that LL-37 dose-response curves often exhibit a biphasic pattern: beneficial effects at low concentrations (chemotaxis, antimicrobial activity, keratinocyte migration) and cytotoxicity at high concentrations. A researcher who selects a single concentration without a pilot dose-response study risks selecting a cytotoxic dose and interpreting cell death as a null biological effect.
Formulation also matters. LL-37 aggregates in some buffer conditions, and aggregated forms are more cytotoxic than monomeric forms. The presence of divalent cations such as calcium and magnesium can reduce LL-37 activity by shielding the negative charges on microbial membranes. These are not minor technical details. They are central to the interpretation of any LL-37 experiment.
GHK-Cu safety margin
GHK-Cu has a wide safety margin in cell culture and animal models. It does not disrupt membranes. It does not aggregate into pore-forming structures. Cytotoxicity has been reported only at concentrations far above the research-relevant range. This makes GHK-Cu easier to work with in standard cell-culture protocols and in topical formulation research where the peptide must remain active in complex vehicles.
Topical formulation differences
GHK-Cu is small enough to be formulated into creams, serums, and gels with reasonable expectation of some degree of skin penetration, particularly if the stratum corneum is compromised by microneedling, chemical exfoliation, or disease. The cosmetic industry has invested heavily in GHK-Cu formulation science, and that literature can inform research design.
LL-37 is not a viable topical agent without advanced delivery technology. Its size and charge prevent meaningful passive penetration. Research protocols that use LL-37 for skin models typically employ injection, implantation, or engineered delivery systems rather than simple topical application. A supplier page that markets LL-37 as a topical skin peptide without acknowledging the delivery challenge is not providing accurate scientific framing.
Sourcing and analytical standards
A credible Canadian supplier should make GHK-Cu and LL-37 easier to distinguish, not harder. The minimum documentation for each peptide is specific to its mechanism and risk profile.
GHK-Cu documentation
A credible GHK-Cu product listing should provide:
- Peptide identity by mass spectrometry, confirming the 340-Da tripeptide
- Copper content analysis, since the research-relevant form is the copper complex
- HPLC purity, with the chromatogram showing a clean main peak
- Heavy-metal screening, to confirm absence of contaminant metals other than copper
- Fill amount, salt form, and storage conditions
- Clear research-use-only language
Cosmetic-grade GHK-Cu, when available through an appropriate documented route, should carry additional documentation about formulation suitability, pH stability, and compatibility with common cosmetic excipients. Northern Compound's best skin peptides buyer guide and topical peptides methodology guide explain those standards in detail. This article does not route cosmetic-grade GHK-Cu through a ProductLink because the confirmed live purchase-intent paths here are GHK-Cu and LL-37.
LL-37 documentation
A credible LL-37 product listing should provide:
- Sequence identity by mass spectrometry, confirming the 4,493-Da, 37-amino-acid cathelicidin
- HPLC purity, with attention to aggregate peaks that may indicate formulation instability
- Endotoxin testing, since LL-37 is often studied in immune models where endotoxin confounds are catastrophic
- Cytotoxicity data or concentration guidelines, to help researchers avoid inadvertently selecting a lethal dose
- Fill amount, salt form, and storage conditions
- Clear research-use-only language
Researchers should be cautious if a supplier provides only a generic purity percentage without chromatogram, mass spectrum, or endotoxin data. LL-37 is particularly vulnerable to aggregation during storage, and an old or poorly handled batch may have shifted from monomeric to oligomeric forms without visible changes in appearance.
Study-design checklist for GHK-Cu versus LL-37
A practical comparison should answer at least ten questions before any result is interpreted.
- Is the endpoint collagen synthesis, angiogenesis, microbial clearance, immune cell recruitment, barrier repair, or biofilm disruption?
- Is the wound model sterile or infected?
- Is the experimental exposure model topical, barrier-disrupted, ex vivo, in vitro, or device-mediated?
- Does the concentration range include a pilot cytotoxicity screen, especially for LL-37?
- Does the COA match the exact lot in hand?
- Does the COA include HPLC purity and mass-spectrometry identity?
- For GHK-Cu, does the product include copper content verification?
- For LL-37, does the product include endotoxin testing and monomeric purity data?
- Are storage and handling conditions equivalent across comparison arms?
- Does the write-up avoid personal-use, cosmetic treatment, or therapeutic claims?
If those questions cannot be answered, the study may still be exploratory, but the conclusion should be modest. A weakly documented product cannot support a strong comparison.
Frequently asked questions
Bottom line for Canadian researchers
GHK-Cu and LL-37 are both relevant to skin and wound research, but they belong to different research lanes. GHK-Cu is a copper-binding tripeptide that signals tissue remodelling, collagen synthesis, and angiogenesis. LL-37 is a cationic antimicrobial cathelicidin that signals innate immunity, microbial defence, and immune cell coordination. A researcher who treats them as interchangeable is asking the wrong experimental question.
For collagen-focused dermal remodelling, photoaging models, or topical formulation research, GHK-Cu is generally the more direct conceptual fit. For infected wound models, biofilm research, barrier immunology, or immune cell chemotaxis, LL-37 is the more appropriate tool. In both cases, the documentation standard is the same: verify the batch, read the COA, confirm identity, preserve research-use-only boundaries, and avoid turning mechanistic speculation into therapeutic promise.
That discipline is what separates a useful skin-peptide comparison from a cosmetic-market article with scientific vocabulary pasted on top.
Further reading
Skin
GHK-Cu in Canada: A Research Guide to Copper Peptides and Skin Remodelling
Why GHK-Cu belongs in the skin archive GHK-Cu Canada searches usually come from two very different audiences. One audience has seen copper peptides in skin-care products and wants...
Skin
LL-37 in Canada: A Research Guide to the Antimicrobial Peptide and Skin Barrier
Why LL-37 belongs in the skin archive LL-37 Canada searches usually come from researchers who have encountered the peptide in immunology, microbiology, dermatology, or...
Skin
Topical Peptides in Canada: A Research Guide to Transdermal Delivery, Stability, and Dermal Models
Why topical peptide research deserves its own guide Topical peptide research sits at an uncomfortable intersection. On one side is the cosmetic industry, which has adopted peptide...